PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000298505
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 617aa    MW: 70098.2 Da    PI: 9.0804
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000298505genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw++yl
    MDP0000298505 15 KGSWTPEEDKRLLAYIQLHGHGSWRSLPQKAGLKRCGKSCRLRWRNYL 62
                     799********************************************7 PP

2Myb_DNA-binding491.4e-1568110145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++  Ed+ +++++++lG++ W++Ia++++ +Rt++++k++w+
    MDP0000298505  68 RGNFSLHEDQTIIQLHALLGNR-WSAIAAHLP-KRTDNEIKNYWN 110
                      89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.1531066IPR017930Myb domain
SuperFamilySSF466894.31E-3012109IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-231265IPR009057Homeodomain-like
SMARTSM007171.3E-141464IPR001005SANT/Myb domain
PfamPF002494.9E-171562IPR001005SANT/Myb domain
CDDcd001671.30E-101762No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2466117IPR009057Homeodomain-like
SMARTSM007178.4E-1667115IPR001005SANT/Myb domain
PROSITE profilePS5129418.78167117IPR017930Myb domain
PfamPF002494.3E-1468111IPR001005SANT/Myb domain
CDDcd001673.10E-1070113No hitNo description
PfamPF142236.2E-21419555No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MGKSSGYPPA SGIKKGSWTP EEDKRLLAYI QLHGHGSWRS LPQKAGLKRC GKSCRLRWRN  60
YLRPDIKRGN FSLHEDQTII QLHALLGNRW SAIAAHLPKR TDNEIKNYWN ANLKKRLAKI  120
GFDPVTHKSK AAILASANGD PKKLSNLSHI AQWESARLQA EARFVKESKL RMHESAPAVS  180
FFDDYHQLAP PLVPQCLDIL EASAWESLIS MSKSSSRSAA LTNDINGLDH HHVHDHGLNM  240
NGQDYGPNFQ VPISDQQLSS LMGFDEATAP SVATGSMNIN EHFGQYCGNE CSELLVVLHQ  300
NIGFESEDAW TSLEKLMSQM STYVTLDDPF AFDDSHAMXA IWQDPRIVVM DQTXVNATGV  360
KNPLPEKPEK FKGVDFKRWQ QKMLFFLTTM NLAHVVKEEA PVVTELPADK DMLSAIDAWT  420
HSEFLCRNYI LNGLDDCLYD VYSSCKTAKD LWDSLTKKYI XEDAGSKKFI IGKFLKFNMV  480
DSKPVMGQVX ELQRLIHDLH AEGCSINEHF QVGAIIEKLP SSWNDFKIYX KHKRREMSXE  540
DLILRLRVEE DHRKGDKADA SXMEAKANFV EASNPRPKHF QKNKEKNAKK KKLTIHHQKQ  600
RIQKNQRSML GVRKTGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-24151174105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-241311725128MYB TRANSFORMING PROTEIN
1mse_C3e-24151174105C-Myb DNA-Binding Domain
1msf_C3e-24151174105C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393175.10.0PREDICTED: protein ODORANT1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.12e-84myb domain protein 106